(1) Haemochromatosis is a mild autosomal recessive condition. Approximately 1 in 200 Australians have the condition, and approximately 1 in 7 Australians are carriers. Jane is planning on starting a family, and does not have haemochromatosis, though her mother is affected with the condition. Her father is not affected, and is not a carrier. Jane’s partner Steve does not have the condition either, but his father is a carrier (his mother is not a carrier).

(a) What are the chances their first child will be affected with haemochromatosis? (hint: draw a family pedigree)

(b)Unfortunately, things don't work out with Steve. Jane is now planning to have a child with Fred, who is not affected with haemochromatosis. Fred was adopted and knows nothing about his biological family, except that they are Australian. What are the chances that Jane and Fred’s first child will be affected with haemochromatosis?

Cheney and Seyfarth recorded one vervet monkey making a
call that indicates danger from another group of vervets
(wrrr)
• They played the wrrr call to the group, and group
began to ignore it
• They then played another call from the same monkey
which means more or less the same thing (chutter)
• The group immediately ignored that, suggesting that
they implicitly treated the particular calling monkey to
be unreliable at calling about approaching groups of
other monkeys

What control condition would need to be run to make sure that the vervets who ignored the wrrr and chutter calls treated the two calls as referring to the same situation, vs. just treating the particular monkey whose calls were being played as generally unreliable?

would it be another group of monkey but under what setting since it's a control condition? Please help

Please, answer this question

Identify the hormones of the anterior and posterior pituitary along with their target organs and their functions.

IBMX is isobutyl methyl xanthine, one of several modified xanthines (purines) that act as phosphodiesterase inhibitors. How and where would IBMX effect the PKA pathway?

Write A summary:

5.2 SHELTERING IN PLACE

In normal operations, a building does little to protect occupants from airborne hazards outside the building because outdoor
air must be continuously introduced to provide a comfortable, healthy indoor environment. However, a building can provide substantial protection against agents released outdoors if the flow of fresh air is filtered/cleaned, or temporarily interrupted or re- duced. Interrupting the flow of fresh air is the principle applied in the protective action known as sheltering in place.The advantage of sheltering in place is that it can be implemented rapidly. The disadvantage is that its protection is variable and di- minishes with the duration of the hazard. Sheltering requires that two distinct actions be taken without delay to maximize the passive protection a building provides:

❍ First, reduce the indoor-outdoor air exchange rate before
the hazardous plume arrives. This is achieved by closing all windows and doors, and turning off all fans, air conditioners, and combustion heaters.

❍ Second, increase the indoor-outdoor air exchange rate as soon as the hazardous plume has passed. This is achieved by opening all windows and doors, and turning on all fans to ventilate the building.

The level of protection that can be attained by sheltering in place is substantial, but it is less than can be provided by high effi- ciency filtration of the fresh air introduced into the building. The amount of protection varies with:

❍ The building’s air exchange rate. The tighter the building (i.e., the lower the air exchange rate), the greater the protection it provides. In most cases, air conditioners and combustion heaters cannot be operated while sheltering in place because operating them increases the indoor-outdoor exchange of air.

❍ The duration of exposure. Protection varies with time, diminishing as the time of exposure increases. Sheltering in place is, therefore, suitable only for exposures of short duration, roughly 2 hours or less, depending on conditions.

❍ Purging or period of occupancy. How long occupants remain in the building after the hazardous plume has passed also affects the level of protection. Because the building slowly purges contaminants that have entered it, at some point during plume passage, the concentration inside exceeds the concentration outside. Maximum protection is attained by

increasing the air exchange rate after plume passage or by exiting the building into clean air.

❍ Natural filtering. Some filtering occurs when the agent is deposited in the building shell or upon interior surfaces as air passes into and out of the building. The tighter the building, the greater the effect of this natural filtering.

• What is the net reaction that HIV protease catalyzes. \ list the substrates and products

Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK -- Select from the list below ALL statements that are TRUE. *

• The name of the protein is called DSUP or damage supressor.
• The protein is a highly lethal toxin factor.
• There appears to be only one known example of the protein in the database.
• The protein comes from an organism called a water bear.
• There are at least five other homologs to the protein including egg stalk protein

what do you suggest me for writing a master thesis of medical student ??please suggest me as much as more topics you guess

A. After studying nutrition science, you should be knowledgeable about nutrition guidelines and how nutrition can affect health. Please demonstrate what you have learned by explaining the following:

• Using terms and concepts that you have learned in this course, examine 8 aspects of your own diet, and explain any changes you may or may not make. For full credit, support each of your 8 choices with facts from the readings. (For example, currently, I rarely eat any nuts. So, I will start eating one ounce of nuts a day because it will improve my cholesterol level, which will reduce my risk for heart disease. Note: you may not use this example.) [32 points]

B. Explain how nutrients affect disease prevention and management. Make your answer specific with examples. Link the nutrient or nutrients you discuss to a condition. (For example, vitamin C deficiency is linked to scurvy. Note: you may not use this example). For full credit, you must provide at least three examples of how nutrient levels can be related to disease prevention and management. [18 points]

1. Describe the following relationships:
   1. Nucleotides and DNA
   2. Genes, intergenic regions and DNA
   3. DNA, histones, and nucleosomes
   4. Nucleosomes and chromatin
   5. Chromatin and chromosome
   6. DNA, nucleus, mitochondria and genome

While chatting about neural oscillations at a party, someone tells you that they believe that neural oscillations are exhaust fumes of the brain. Write your response to them below, and provide an example from at least two published, peer-reviewed experiments to support why you agree or disagree with their statement

1. State what the function(s) of the following nuclear components and why each is important to the cell. (Provide details, don’t just say “ribosomes are the location of translation.” What is translation) nuclear envelope, lamins and nuclear lamina, ER, ribosomes, nuclear pore, and nucleolus. Remember, this is a study tool, the more detailed you are here, the better understanding you have of the info.

Explain when plants and animals first showed up on earth. Include geologic time frame.

1. Address the following regarding Oxidative Phosphorylation?
   1. Why are the processes of the ETC and ATP Synthase always coupled? What is the “oxidative” part refer to? What is the “phosphorylation” refer to?
   2. What type of transport is the ETC an example of? Explain why.
   3. Discuss how Ox-Phos is similar to the active transport of glucose.
   4. Define/Discuss the relationship between proton motive force, electrochemical gradient before/after ETC, ATP synthase and chemiosmosis (via ATP synthase).