Question

In: Biology

Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKA

Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK -- Select from the list below ALL statements that are TRUE. *

  • The name of the protein is called DSUP or damage supressor.
  • The protein is a highly lethal toxin factor.
  • There appears to be only one known example of the protein in the database.
  • The protein comes from an organism called a water bear.
  • There are at least five other homologs to the protein including egg stalk protein

Solutions

Expert Solution

We are given a protein sequence and asked to run a BLAST program using the Uniprot database. To do this, we need to open the uniprot website and click BLAST . A window would open for us to paste the given sequence after which we would click the "Run BLAST" link at the bottom of the window and wait for the results to appear.

Once the results appear, we can answer the questions based on the results obtained:

  • The name of the protein is called DSUP or damage supressor.

The above statement is true. The top of the uniprot results say that the query sequence matches 100% with that of DSUP.

  • The protein is a highly lethal toxin factor.

This statement would be false. The description of the DSUP in the database states that the protein protects the DNA of the cell from damage due to environmental stress. So it cannot be a toxin factor.  

  • There appears to be only one known example of the protein in the database.

This statement is true. As there is only one result that appeared in the BLAST that matched 100%, the rest were insignificant as they were 25% matches. The 100% match was that of the DSUP protein from Ramazzottius varieornatus , which is commonly known as water bear.

  • The protein comes from an organism called a water bear.

This statement is true, as mentioned earlier the protein belongs to the species Ramazzottius varieornatus which is the binomial name for water bear.

  • There are at least five other homologs to the protein including egg stalk protein

This statement would be false, as no such information is given in the database pertaining to the structure of the protein, which shows only the DNA and nucleosome binding domains


Related Solutions

Using the sequence of the BPSL1549 protein – carry out an NCBI BLAST search using an...
Using the sequence of the BPSL1549 protein – carry out an NCBI BLAST search using an appropriate BLAST program for the type of input sequence and restrict your search to the non redundant protein sequences (nr) database.What does the list of significant alignments tell you? Select all that apply. * Most of the hits appears to belong mainly in the genus Burkholderia. There appears to be a B. mallei homolog that has an acceptable E value but only has a...
A BLAST search using the amino acid sequence of human parathyroid hormone (PTH) against the protein and DNA sequence databases returned close homologs in many vertebrate species ranging from primates to fish
A BLAST search using the amino acid sequence of human parathyroid hormone (PTH) against the protein and DNA sequence databases returned close homologs in many vertebrate species ranging from primates to fish, but no sequence homologs in bacteria, archaea, plants, fungi, slime moulds, arthropods or nematodes. With reference to the tree of life shown above, where do you think PTH evolved? Explain your answer.
i just performed a BLAST search with a query protein sequence of unknown function. The top...
i just performed a BLAST search with a query protein sequence of unknown function. The top hit was an alcohol dehydrogenase sequence with an E value of 6x10-12. What does this result suggest about your query sequence and why? i just want to know the meaning of the e value like what the e value depicts
1.Carry out library search to find out if the bacteria and yeast form alcohol in the...
1.Carry out library search to find out if the bacteria and yeast form alcohol in the absence of oxygen or they possess a metabolic pathway that does not involve oxygen. Write down your findings 2. What would happen if the first enzyme in glycolysis is irreversible inhibited by a toxic substance? PLEASE HELP ME ALL QUESTIONS
advantages of using a protien sequence rather than a DNA sequence when searching the bioinformatics database
advantages of using a protien sequence rather than a DNA sequence when searching the bioinformatics database
Carry out a personal SWOT analysis against the current and future leadership requirements of a suitable...
Carry out a personal SWOT analysis against the current and future leadership requirements of a suitable job role. Within this analysis identify leadership and management standards that would be a useful benchmark. Research at least two different learning styles e.g Kolb's learning cycle and provide a critical analysis of how people learn. This can be in the form of an inventory or questionnaire to identify your own preferred learning style.
Carry out a personal SWOT analysis against the current and future leadership requirements of a suitable...
Carry out a personal SWOT analysis against the current and future leadership requirements of a suitable job role. Within this analysis identify leadership and management standards that would be a useful benchmark. Research at least two different learning styles e.g Kolb's learning cycle and provide a critical analysis of how people learn. This can be in the form of an inventory or questionnaire to identify your own preferred learning style. (2.2).
Which of the following is NOT available with a half adder? Sum Carry In Carry Out...
Which of the following is NOT available with a half adder? Sum Carry In Carry Out None of the above For an 8x1 multiplexer, how many control signals/inputs are in need? 1     2 3 4 How many outputs are there for a decoder with 4 inputs (assuming no extra control signals/inputs)? 4 8 12 16 After a logic right-shift (by one position), a given sequence 1100 1110 turns into 1100 1110 0110 0111 1110 0111 1001 1100 After a logic...
Prompt: Using the SEC’s EDGAR database, search for a large public company and download the most...
Prompt: Using the SEC’s EDGAR database, search for a large public company and download the most recent Form 10-K. This form contains all the information that must be reported annually to the SEC. Within this form, ensure that it includes footnotes, the management discussion and analysis (MD&A) sections, review each of the previously listed sections, and discuss any off-balance sheet financing, management concerns, management’s expectations for the future, and anything interesting or out of the ordinary. Feel free to supplement...
Go to the WCU Library and search the database for the following article. Read the article,...
Go to the WCU Library and search the database for the following article. Read the article, and then answer the questions that follow: Soriano S., Alonso-Magdalena P., Garcıa-Arevalo M., Novials A., & Muhammed S. J. (2012). Rapid insulinotropic action of low doses of Bisphenol-A on mouse and human islets of langerhans: Role of estrogen receptor b. PLoS ONE 7(2): e31109. doi:10.1371/journal.pone.0031109 What are the causes of type 2 diabetes? What is the relationship between insulin resistance and hyperinsulinemia? What are...
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT