Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK -- Select from the list below ALL statements that are TRUE. *

• The name of the protein is called DSUP or damage supressor.
• The protein is a highly lethal toxin factor.
• There appears to be only one known example of the protein in the database.
• The protein comes from an organism called a water bear.
• There are at least five other homologs to the protein including egg stalk protein

what do you suggest me for writing a master thesis of medical student ??please suggest me as much as more topics you guess

A. After studying nutrition science, you should be knowledgeable about nutrition guidelines and how nutrition can affect health. Please demonstrate what you have learned by explaining the following:

• Using terms and concepts that you have learned in this course, examine 8 aspects of your own diet, and explain any changes you may or may not make. For full credit, support each of your 8 choices with facts from the readings. (For example, currently, I rarely eat any nuts. So, I will start eating one ounce of nuts a day because it will improve my cholesterol level, which will reduce my risk for heart disease. Note: you may not use this example.) [32 points]

B. Explain how nutrients affect disease prevention and management. Make your answer specific with examples. Link the nutrient or nutrients you discuss to a condition. (For example, vitamin C deficiency is linked to scurvy. Note: you may not use this example). For full credit, you must provide at least three examples of how nutrient levels can be related to disease prevention and management. [18 points]

1. Describe the following relationships:
   1. Nucleotides and DNA
   2. Genes, intergenic regions and DNA
   3. DNA, histones, and nucleosomes
   4. Nucleosomes and chromatin
   5. Chromatin and chromosome
   6. DNA, nucleus, mitochondria and genome

While chatting about neural oscillations at a party, someone tells you that they believe that neural oscillations are exhaust fumes of the brain. Write your response to them below, and provide an example from at least two published, peer-reviewed experiments to support why you agree or disagree with their statement

1. State what the function(s) of the following nuclear components and why each is important to the cell. (Provide details, don’t just say “ribosomes are the location of translation.” What is translation) nuclear envelope, lamins and nuclear lamina, ER, ribosomes, nuclear pore, and nucleolus. Remember, this is a study tool, the more detailed you are here, the better understanding you have of the info.

Explain when plants and animals first showed up on earth. Include geologic time frame.

1. Address the following regarding Oxidative Phosphorylation?
   1. Why are the processes of the ETC and ATP Synthase always coupled? What is the “oxidative” part refer to? What is the “phosphorylation” refer to?
   2. What type of transport is the ETC an example of? Explain why.
   3. Discuss how Ox-Phos is similar to the active transport of glucose.
   4. Define/Discuss the relationship between proton motive force, electrochemical gradient before/after ETC, ATP synthase and chemiosmosis (via ATP synthase).

Outline the functions of the following hormones in relation to digestion and/or the maintenance of metabolic balance: gastrin, cholecystokinin (CCK), insulin, glucagon and leptin.

What are the sources of nitrogenous wastes in animals, and how are these converted and eliminated in the osmoregulatory systems of invertebrates, insects, bony fish, mammals and birds?   

1. You are interested in cloning a gene from the B. sanfranciscus genome, so you design PCR primers that should amplify a 1 kilobase pair (kbp) PCR product that contains the gene of interest.  After amplification, you will see if the PCR  was successful by loading the entire reaction onto an agarose gel and performing electrophoresis to see if a product of the expected size was generated.  To visualize the DNA, you will stain the gel with a fluorescent dye called ethidium bromide, which fluoresces when it binds to DNA. The sensitivity of ethidium-bromide-stained DNA is 10 nanograms (i.e. – there must be at least 10 ng of DNA in the band in the gel to emit a detectable amount of light).

If your PCR reaction initially contained 30 B. sanfranciscus genomes, how many cycles of PCR will required before there is a detectable amount of amplified product?  You can assume:  a) there is 1 copy of the gene per genome, b) the PCR occurs with perfect efficiency and therefore the amount of product doubles after each cycle, and, c) that the molecular weight of a 1 kbp molecule of DNA is 6.5 x 10⁵Daltons. Express your answer in the number of complete (not fractional) cycles and show your work.

Discuss the prevention for meningitis. Please be VERY detailed.

How COL1A1 gene is related to collagen? How is this gene regulated? How is the collagen protein that is formed? What is specific structure, what is function of this protein? How is this protein regulated post-translationally?

What is protein that is related to p53 gene? How is this gene regulated? What is the protein that is formed? What is specific structure, what is function of this protein? How is this protein regulated post-translationally?

for the uracil:
1. Describe chemical characteristics, classification and biological molecule in which it is found
2. Identify each of the parts that make it up and graph nitrogenous base, nucleoside and nucleotide.