The Human Genome Project's utility in identifying the disease-causing gene in albinism AND it's mode of inheritance
In: Biology
Scenario: While shopping in a local nursery, you meet Albert. Albert recently bought a new house in the Elk Grove area. He wants to do some landscaping and put in a summer vegetable garden. You both get to talking about the local environment and soil conditions. Albert complains about how impossible his heavy clay seems to work with. While commiserating with Albert, he comments to you that he is just going to truck in 6 inches of top soil and plant in that. What are your thoughts on this practice? What recommendations could you give Albert?
In: Biology
Please, answer this question
Identify the structural characteristics and functions of the cellular elements of blood.
In: Biology
Describe three types of post-transcriptional regulation of protein–coding genes
In: Biology
If a mutation prevented the synthesis of any of the linker proteins, what step(s) in meiosis would not occur? Why is / are that step(s) important?
In: Biology
(1) Haemochromatosis is a mild autosomal recessive condition. Approximately 1 in 200 Australians have the condition, and approximately 1 in 7 Australians are carriers. Jane is planning on starting a family, and does not have haemochromatosis, though her mother is affected with the condition. Her father is not affected, and is not a carrier. Jane’s partner Steve does not have the condition either, but his father is a carrier (his mother is not a carrier).
(a) What are the chances their first child will be affected with haemochromatosis? (hint: draw a family pedigree)
(b)Unfortunately, things don't work out with Steve. Jane is now planning to have a child with Fred, who is not affected with haemochromatosis. Fred was adopted and knows nothing about his biological family, except that they are Australian. What are the chances that Jane and Fred’s first child will be affected with haemochromatosis?
In: Biology
Cheney and Seyfarth recorded one vervet monkey making a
call that indicates danger from another group of vervets
(wrrr)
• They played the wrrr call to the group, and group
began to ignore it
• They then played another call from the same monkey
which means more or less the same thing (chutter)
• The group immediately ignored that, suggesting that
they implicitly treated the particular calling monkey to
be unreliable at calling about approaching groups of
other monkeys
What control condition would need to be run to make sure that the vervets who ignored the wrrr and chutter calls treated the two calls as referring to the same situation, vs. just treating the particular monkey whose calls were being played as generally unreliable?
would it be another group of monkey but under what setting since it's a control condition? Please help
In: Biology
In: Biology
Please, answer this question
Identify the hormones of the anterior and posterior pituitary along with their target organs and their functions.
In: Biology
IBMX is isobutyl methyl xanthine, one of several modified xanthines (purines) that act as phosphodiesterase inhibitors. How and where would IBMX effect the PKA pathway?
In: Biology
Write A summary:
5.2 SHELTERING IN PLACE
In normal operations, a building does little to protect
occupants from airborne hazards outside the building because
outdoor
air must be continuously introduced to provide a comfortable,
healthy indoor environment. However, a building can provide
substantial protection against agents released outdoors if the flow
of fresh air is filtered/cleaned, or temporarily interrupted or re-
duced. Interrupting the flow of fresh air is the principle applied
in the protective action known as sheltering in place.The advantage
of sheltering in place is that it can be implemented rapidly. The
disadvantage is that its protection is variable and di- minishes
with the duration of the hazard. Sheltering requires that two
distinct actions be taken without delay to maximize the passive
protection a building provides:
❍ First, reduce the indoor-outdoor air exchange rate
before
the hazardous plume arrives. This is achieved by closing all
windows and doors, and turning off all fans, air conditioners, and
combustion heaters.
❍ Second, increase the indoor-outdoor air exchange rate as soon as the hazardous plume has passed. This is achieved by opening all windows and doors, and turning on all fans to ventilate the building.
The level of protection that can be attained by sheltering in place is substantial, but it is less than can be provided by high effi- ciency filtration of the fresh air introduced into the building. The amount of protection varies with:
❍ The building’s air exchange rate. The tighter the building (i.e., the lower the air exchange rate), the greater the protection it provides. In most cases, air conditioners and combustion heaters cannot be operated while sheltering in place because operating them increases the indoor-outdoor exchange of air.
❍ The duration of exposure. Protection varies with time, diminishing as the time of exposure increases. Sheltering in place is, therefore, suitable only for exposures of short duration, roughly 2 hours or less, depending on conditions.
❍ Purging or period of occupancy. How long occupants remain in the building after the hazardous plume has passed also affects the level of protection. Because the building slowly purges contaminants that have entered it, at some point during plume passage, the concentration inside exceeds the concentration outside. Maximum protection is attained by
increasing the air exchange rate after plume passage or by exiting the building into clean air.
❍ Natural filtering. Some filtering occurs when the agent is deposited in the building shell or upon interior surfaces as air passes into and out of the building. The tighter the building, the greater the effect of this natural filtering.
In: Biology
In: Biology
Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK -- Select from the list below ALL statements that are TRUE. *
In: Biology
what do you suggest me for writing a master thesis of medical student ??please suggest me as much as more topics you guess
In: Biology
A. After studying nutrition science, you should be knowledgeable about nutrition guidelines and how nutrition can affect health. Please demonstrate what you have learned by explaining the following:
B. Explain how nutrients affect disease prevention and management. Make your answer specific with examples. Link the nutrient or nutrients you discuss to a condition. (For example, vitamin C deficiency is linked to scurvy. Note: you may not use this example). For full credit, you must provide at least three examples of how nutrient levels can be related to disease prevention and management. [18 points]
In: Biology