Question
In: Biology
Using the Arizona Wuhan seafood market virus isolate, MN997409.1, run BLAST against the RefSeq Representative genomes...
Using the Arizona Wuhan seafood market virus isolate, MN997409.1, run BLAST against the RefSeq Representative genomes (refseq_representative_genomes) database, limiting the search to Viruses (taxid: 10239) in the “Organism” field. From the hits returned, construct a phylogenetic tree (Distance tree of results). Examining the BLAST results and the Distance Tree select all that apply:
a)The non-Wuhan virus genome with the lowest E-value and highest identity is the SARS coronavirus
b)The distance tree suggests the Arizona virus is very different from the reference Wuhan seafood market virus isolate
c)The Distance tree suggests that the Wuhan viruses show similarity to a Bat coronavirus – BM48-31/BGR/2008
d)The White-eye corona virus show a significant hit, but with very low Query coverage
Solutions
Expert Solution
Question
The result from blastn alignment is following:
Figure: BLASTn result
This result show that non-wuhan virus show similarity with SARS coranavirus. Hence, option a is correct.
gladiator answered 3 weeks agoRelated Solutions
Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKA
Carry out a BLAST search against the UniProt database using the
following sequence as input:
MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK
-- Select from the list below ALL statements that are TRUE. *
The name of the protein is called DSUP or damage
supressor.
The protein is a highly lethal toxin factor.
There appears to be only one known example of the protein in
the database.
The protein comes from an organism called a water bear.
There are at least five other homologs to the...
Consider a representative firm in the perfectly competitive market. This firm has the following total long-run...
Consider a representative firm in the perfectly competitive
market.
This firm has the following total long-run cost function
(C):
C = 2q^2 + 8
where q is the output quantity produced by the firm. Suppose
further that the
market demand is given as: QD = 130-P where QD is the quantity
demanded in the market and P is the output price. Find the long-run
market equilibrium price and the number of firms in the market.
Describe a strategy for how you would make a vaccine against a virus using genetic engineering...
Describe a strategy for how you would make a vaccine against a
virus using genetic engineering and protein expression and
purification system (i.e. from gene cloning to protein
purification).
Research the methods attackers are using to bypass virus scanners to get users to run malicious...
Research the methods attackers are using to bypass virus
scanners to get users to run malicious code. Theorize some
mitigation methods
You run a regression of X’ Company stock's returns against the market returns over a five-year...
You run a regression of X’ Company stock's returns against the
market returns over a five-year time period (using monthly data)
and come up with the following output: Intercept = .20%, Slope =
1.20 Your stock had an annualized standard deviation of returns of
40% whereas the market standard deviation was only 20%. The
annualized risk-free rate, on average, over the last five years has
been 6% and it is currently at 7%. The risk premium = 8.5%. The
annualized...
You run a regression of X’ Company stock's returns against the market returns over a five-year...
You run a regression of X’ Company stock's returns
against the market returns over a five-year time period (using
monthly data) and come up with the following output: Intercept =
.20%, Slope = 1.20
Your stock had an annualized standard deviation of
returns of 40% whereas the market standard deviation was only 20%.
The annualized risk-free rate, on average, over the last five years
has been 6% and it is currently at 7%. The risk premium = 8.5%. The
annualized...
You have run a regression of payout ratios against expected growth and risk (beta) for all companies in the market and arrived at the following equation:
You have run a regression of payout ratios against expected growth and risk (beta) for all companies in the market and arrived at the following equation:Payout ratio = 0.80 1.2 (Expected growth) - .25 (Beta)Using this regression, estimate the payout ratio for a firm with an expected growth rate of 20% and a beta of 1.2.a. 0%b. 26%c. 50%d. 56%e. 80%
Using ONLY a single market model, compare and contrast the long run equilibrium outcomes of perfectly...
Using ONLY a single market model, compare and contrast the long
run equilibrium outcomes of perfectly competitive markets and
monopoly markets. Make sure to clearly identify the deadweight loss
that occurs along with labeling the prices and quantities charged
by each market structure. (10 pts)
A BLAST search using the amino acid sequence of human parathyroid hormone (PTH) against the protein and DNA sequence databases returned close homologs in many vertebrate species ranging from primates to fish
A BLAST search using the amino acid sequence of human
parathyroid hormone (PTH) against the protein and DNA sequence
databases returned close homologs in many vertebrate species
ranging from primates to fish, but no sequence homologs in
bacteria, archaea, plants, fungi, slime moulds, arthropods or
nematodes. With reference to the tree of life shown above, where do
you think PTH evolved? Explain your answer.
9 using cobweb behavior show the long run adjustment path in an agricultural market when demand...
9 using cobweb behavior show the long run adjustment path in an
agricultural market when demand is more elastic that supply and
when supply is more elastic than demand. what can be concluded from
the two models
10 what are the four key interrelated structural characteristics
that are necessary to exhibit perfect or imperfect competition
behavior of the market? explain each briefly
. 11 explain the short run and long run equilibrium of a
monopolistically competitive industry
ADVERTISEMENT
ADVERTISEMENT
Latest Questions
- The Fed offers three types of discount window loans. ______________ credit is offered to small institutions...
- How to create a camscanner program
- Give your opinion on how accounting information is utilized in collaboration to manage finances better and...
- National Co. manufactures and sells three products: red, white, and blue. Their unit sales prices are...
- For this assignment, you will complete a 15-30 minute session of any type of massage or...
- You work for a firm that is currently selling a generic allergy medication. Recently there was...
- What are the opportunity costs of developing wind farms to generate “clean” electricity? Should we make...
ADVERTISEMENT