Question

In: Biology

Talking about the protein "TITIN" Describe the primary, secondary, tertiary, and quaternary structure. Include sequences, images,...

Talking about the protein "TITIN"

Describe the primary, secondary, tertiary, and quaternary structure. Include sequences, images, secondary/tertiary/quaternary structures, and data from online resources (properly citing them).

Solutions

Expert Solution

Primary structure: Amino acid sequence of TITIN.

(Note: Sequence taken from NCBI with Genbank ID: CAA62188.1.The below is not the complete sequence)

MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAV
TKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPNPVVKFYRD
GAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVST
AQISESRQTRIEKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ
QSPSPIRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGY
VASSSEAEMRETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA
DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVAADKAKEQE
LKSRTKEIITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRISEEITKKQKQVTQEAIMKETR
KTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRTR
ETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREPGHLEESYAQQTTLEYGYKERISAAKV
AEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHF
TVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADT
PDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIE
GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVST

Secondary structure: ?-helix and ?-sheets present in the structure.

(Note: structure was taken from PDB with ID: 5JDD)

Tertiary structure: Subunits present in the protein. (Marked by red circle)

Quaternary structure: The whole protein

gladiator answered 2 years ago
Next > < Previous

Related Solutions

Explain the primary, secondary, tertiary and quaternary structure of the proteins.
Explain the primary, secondary, tertiary and quaternary structure of the proteins.
Describe primary, secondary, tertiary, and quaternary structure and differentiate among the structures based on Stabilization by...
Describe primary, secondary, tertiary, and quaternary structure and differentiate among the structures based on Stabilization by intramolecular covalent bonds Stabilization by hydrogen bonds Stabilization by hydrophobic effect Function in binding ligand Regulation of function by allostery
Describe primary, secondary, tertiary, and quaternary structure and differentiate among the structures based on Stabilization by...
Describe primary, secondary, tertiary, and quaternary structure and differentiate among the structures based on Stabilization by intramolecular covalent bonds Stabilization by hydrogen bonds Stabilization by hydrophobic effect Function in binding ligand Regulation of function by allostery
Distinguish between, primary, secondary, tertiary, and quaternary structures of a protein and provide a picture of...
Distinguish between, primary, secondary, tertiary, and quaternary structures of a protein and provide a picture of each. What is the difference between the primary, secondary, tertiary, and quaternary structures within a protein? Could you also provide pictures of these?
Biochemistry question: Describe the four levels of proteins structure (primary, secondary, tertiary and quaternary). Make sure...
Biochemistry question: Describe the four levels of proteins structure (primary, secondary, tertiary and quaternary). Make sure to describe the role of non-covalent interactions involving the main chain or side chains of the amino acids that form to stabilize the structure.
Drag each label into the appropriate bin depending on whether it applies to primary, secondary, tertiary, or quaternary structure
Drag each label into the appropriate bin depending on whether it applies to primary, secondary, tertiary, or quaternary structure
PLEASE TYPE OUT YOUR WORK 1A)Explain the difference between primary, secondary, tertiary, and quaternary structure of...
PLEASE TYPE OUT YOUR WORK 1A)Explain the difference between primary, secondary, tertiary, and quaternary structure of proteins, including similarities and differences in hydrogen bonding of EACH STRUCTURE WITH ONE ANOTHER 1 B) Distinguish between parallel and antiparallel BETA-sheets 1C) which kinds of forces stabilize proteins at different levels of structure, i.e., what stabilizes secondary structure, what causes protein chains to fold into tertiary structure, what holds oligomers together? 1D) which bonds can rotate in proteins, and WHAT ARE the names...
BIO&160 QUESTIONS: 3. Explain how the various levels of structure of proteins (primary, secondary, tertiary, quaternary)...
BIO&160 QUESTIONS: 3. Explain how the various levels of structure of proteins (primary, secondary, tertiary, quaternary) are responsible for protein's very important role as enzymes. In your answer, use the following terms correctly - induced fit, substrate, active site.
what are the similarities between a secondary structure and a tertiary structure of a protein?
what are the similarities between a secondary structure and a tertiary structure of a protein?
QUESTION 1 Protein secondary structure is maintained by __________ bonds and protein tertiary structure is maintained...
QUESTION 1 Protein secondary structure is maintained by __________ bonds and protein tertiary structure is maintained by _____________ 1. Ionic: Covalent bonds 2. Hydrogen: R group interactions 3. R group interactions; hydrogen bonds 4. ionic bonds; R group interactions 10 points    QUESTION 2 Humans (Homo sapiens) have existed in their current form for around _______ years, and agriculture began about ____ years ago 1. 50,000; 20,000 2. 200,000; 10,000 3. 100,000; 2,000 4. 500,000; 10,000 10 points    QUESTION...
ADVERTISEMENT
Subjects
ADVERTISEMENT
Latest Questions
ADVERTISEMENT