Genetic Disorder: Argininosuccinic Aciduria Official full name of the gene responsible for the disorder: Mutations of...

Genetic Disorder: Argininosuccinic Aciduria

Official full name of the gene responsible for the disorder:	Mutations of the Argininosuccinate lyase (ASL) gene is what leads to Argininosuccinic Aciduria disorder. The mutations occur from a lack of deficiency from enzymes.
Official Gene Symbol:	ASL
GenBank Accession Number:	Entrez Gene: 435
Coding sequence:	.
CDS length:
Amino acid sequence:
Amino acid length of protein:
Function of the normal/non-mutated protein:
Mutations implicated in causing the disorder:
Impact of mutations on the structure and/or functioning of the protein:

References:

Expert Solution

Genetic Disorder: Argininosuccinic Aciduria

Official full name of the gene responsible for the disorder:	Mutations of the Argininosuccinate lyase (ASL) gene is what leads to Argininosuccinic Aciduria disorder. The mutations occur from a lack of deficiency from enzymes.
Official Gene Symbol:	ASL
GenBank Accession Number:	NG_009288.1
Coding sequence:	264..275,5985..6179,6550..6633,7062..7118,7259..7356, 10767..10844,10926..11003,11516..11568,11911..11973, 12989..13103,13273..13357,13458..13517,13794..13877, 16188..16268,16739..16845,16950..17094
CDS length:	1395 nt
Amino acid sequence:	"MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKA YSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGA TAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTH LQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRA ELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDA YSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFE VSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASG KAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDW QIRQVRALLQAQQA
Amino acid length of protein:	464
Function of the normal/non-mutated protein:	This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle.
Mutations implicated in causing the disorder:	Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22.
Impact of mutations on the structure and/or functioning of the protein:	Protein does not fold and interact with substrate properly

References: NCBI genbank

gladiator answered 2 years ago

Cystic fibrosis is a genetic disorder where mutated alleles (point or gene mutations) produce a defective...

Cystic fibrosis is a genetic disorder where mutated alleles (point or gene mutations) produce a defective transport protein that results in organs producing a sticky mucus. Discuss how an individual with cystic fibrosis would make the abnormal protein. Your answer should include all the molecules and all the processes involved in going from genotype to phenotype.

In familial retinoblastoma, are mutations in the normal RB1 gene always responsible for the loss of...

In familial retinoblastoma, are mutations in the normal RB1 gene always responsible for the loss of heterozygosity? In a family with retinoblastoma, would the mechanism of loss of heterozygosity in tumors in different members of the family be expected to be same or different? Cite some evidence supporting the conclusion that tumor cells are clonal. A gene for hereditary prostate cancer has been mapped to chromosomal location 1q25; it shows autosomal dominant inheritance. How would you go about identifying the...

Cystic fibrosis is genetic disease caused by mutations in the CFTR gene. The consequence of this...

Cystic fibrosis is genetic disease caused by mutations in the CFTR gene. The consequence of this is production of an abnormal transmembrane protein that is responsible for producing sweat, mucus, and digestive fluids. Explain in depth the correlation between the defective gene and the abnormal protein that is produced. Be sure to mention the process involved in protein production, whether or not those process(s) have occurred, and their end products. Provide details in your explanation and support your answer with...

Ch 14: Mendell and the Gene Idea A new genetic disorder is discovered. Not much is...

Ch 14: Mendell and the Gene Idea A new genetic disorder is discovered. Not much is known about it other than the fact that inability to digest sugar is a symptom. Describe several inheritance patterns the disease may have, including descriptions of how each would affect its expression. Then briefly outline a method we could use to examine the genetics behind the disorder.

Name two examples of loss of function mutations in the Pi transporter gene of E.coli? (If...

Name two examples of loss of function mutations in the Pi transporter gene of E.coli? (If references to scientific journals could also be included, it would be highly appreciated)

24. Name and explain three categories of gene mutations. 25. Albinism is lethal in plants, but...

24. Name and explain three categories of gene mutations. 25. Albinism is lethal in plants, but many plants produce albino offspring. If albino plants always die before reproducing, how does albinism persist?

Explain how natural selection, genetic drift, mutations, and/or gene flow all lead to human genetic variation, using the examples from lab discussion.

Marfan syndrome (MFS) is an autosomal dominant hereditary disorder of connective tissue. It is caused by mutations in the glycoprotein gene, fibrillin-1 (FBN1).

7) Marfan syndrome (MFS) is an autosomal dominant hereditary disorder of connective tissue. It is caused by mutations in the glycoprotein gene, fibrillin-1 (FBN1). This syndrome can be described as a type of _______. a. epistasis b. haploinsufficiency c. aneuploidy d. trisomy --------------------------------------------- 8) Please refer to the following DNA sequence: 5’ GAGGCCTTAAATTT 3’ Which one of the changes listed below would be a structural chromosomal mutation to the sequence above? a. If first adenine is substituted with guanine....

Why are tumor suppressor gene mutations recessive while oncogene mutations are dominant?

10. Mutations in the lacI gene (lacI-) constitutively transcribe the lac operon. Mutations in the operator...

10. Mutations in the lacI gene (lacI-) constitutively transcribe the lac operon. Mutations in the operator region can also occur, also resulting in the constitutive expression of the lac operon. Using the “reagents” described below, design an experiment to test if a mutant that constitutively expresses the lac operon is mutated in the lacI gene or in the operator. X-gal – a colorless chemical that is a substrate for B-galactosidase, when cleaved it produces a blue dye that “stains” any...

Question