human resource planning and forecasting( human resource planning process, forecasting HR requirements, methods to forecast HR needs)

How does traditional security’s immigration policy response exacerbate human trafficking and differ from a human security approach?

Assessment sequence 2

MGKEEKTHINVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERER

GITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALL

AYTLGVRQLIVAINKMDTAKWAEARYQEIIKETSNFIKKVGYNPKTVAFVPISGFHGDNMLTPSTNCPWY

KGWEKEGKSGKVTGKTLLDAIDAVEPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGVLKPGMVVTFA

PSNVTTEVKSVEMHHEQLVEGVPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPSGAATFNAQVIVLNHPG

QVGNGYAPVLDCHTAHIACKFTEILEKIDRRTGKSVENNPKFIKSGDAAIVKLTPSKPMCVEAFTDYPPL

GRFAVRDMRQTVAVGVIKSVEKATAGAGKVTKSAAKAAKK

A) For nucleotide sequence, what is the protein (coded for by the gene for a nucleic acid sequence), and in what biological process is it involved?

B) What is the stop codon

C) How many nucleotides in the coding sequence

D) How many amino acid translated

E) Is the organism a prokaryote or eukaryote

Calculate the overall charge of the following peptide at pH = 6.0. The N-terminus is on the left and C-terminus is on the right. Please use Table 5.1 in your textbook or eText for any pKa values you might need. Also, please refer to Figure 5.3 to interpret the 3-letter amino acid abbreviations. Met - Arg - Lys - Asp - Val - Gln

Actinomycin A is a drug that prevents successful translation by inhibiting elongation. The most likely direct effect of this drug is to prevent the:

a. Binding of the large ribosomal subunit to the small subunit

b. breaking of the bond between tRNA and its amino acid

c. disassociation of the ribosomal subunits

d. start codon from binding

e. formation of peptide bonds between two tRNAs

Lysine is an amino acid which has the following elemental composition: C, H, O, N. In one experiment, 3.263 g of lysine was combusted to produce 5.910 g of CO2 and 2.835 g of H2O. Separate analysis determined that lysine is 19.17% N. The molar mass of lysine is 150 g/mol. Determine the empirical and molecular formulas of lysine.

please create a tool for Gene Expression. This may be a series of drawings, well-organized typed notes, ( Don't handwrite)

You must include ALL the following terms:

Gene

DNA

Transcription

Translation

Codon

RNA

Amino Acid

Protein

Ribosome

tRNA

Promoter

Plasmid

Frameshift

Mutation

Base

Substitution

Missense Mutation

Nonsense Mutation

Silent Mutation

How has Modern agriculture affected human cultures and our planet?

There are two topics present, how modern agriculture has affected the planet and human societies. Explain each topic completely, then draw connections between the two. How has the change in human societies affected how agriculture impacts our world?

In the first by-pass step of gluconeogenesis, the conversion of pyruvate to phosphoenolpyruvate, pyruvate is carboxylated by pyruvate carboxylase to oxaloacetate, which is subsequently decarboxylated by PEP carboxykinase to yield phosphoenolpyruvate. Explain using thermodynamic terms why this by-pass step is necessary. Why couldn't the glycolytic enzyme responsible for interconverting phosphoenolpyruvate and pyruvate also participate in the gluconeogenesis pathway?

The following question refers to the enzyme chymotrypsin.

For an experiment, you are asked to modify the sequence of chymotrypsin so that, it instead of cleaving C-terminal to a Phe/Tyr residue, it cleaves after Lys. Please describe the strategy you would take in your design, considering what you have learned. Please explain with clarity and detail.