Create a C structure which stores information about a student. Each student should be represented by a student ID (integer), first name, last name, day, month and year of birth, and program code (string). Write a C program which creates an array of 100 of these structures, then prompts the user to enter data from the keyboard to fill the array. If an ID of 0 is entered, data entry should finish, and the list of students should be printed to the screen.

USE Python 2.7(screen shot program with output)

the task is: takes in a list of protein sequences as input and finds all the transmembrane domains and returns them in a list for each sequence in the list with given nonpolar regions and returns the lists for those.

1. This code should call two other functions that you write: regionProteinFind takes in a protein sequence and should return a list of 10 amino acid windows, if the sequence is less than 10 amino acids, it should just return that sequence. (initially it should grab amino acids 1-10…the next time it is called it should grab amino acids 2-11…) for each sequence in the list.

testcode:

"protein='MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR''

the regionProteinFind returns:['MKLVVRPWAG','KLVVRPWAGC','LVVRPWAGCW','VVRPWAGCWW','VRPWAGCWWS','RPWAGCWWST','PWAGCWWSTL','WAGCWWSTLG','AGCWWSTLGP','GCWWSTLGPR',
'CWWSTLGPRG','WWSTLGPRGS','WSTLGPRGSL','STLGPRGSLS','TLGPRGSLSP','LGPRGSLSPL','GPRGSLSPLG','PRGSLSPLGI','RGSLSPLGIC','GSLSPLGICP','SLSPLGICPL','LSPLGICPLL','SPLGICPLLM','PLGICPLLML','LGICPLLMLL','GICPLLMLLW','ICPLLMLLWA','CPLLMLLWAT','PLLMLLWATL','LLMLLWATLR']

2nd testcode;

protein=MP

region protein sequence should return: ['ME']

2. A second function called testForTM , which should calculate and return the decimal fraction of ten amino acid window which are nonpolar for each sequence in the list. the nonpolar regions are (A,V,L,I,P,M,F,W). my code for this is:

def testForTM(AAWindow):
totalNP= 0
nonPolarList=['A', 'V', 'L', 'I', 'P', 'M', 'F', 'W']
for aa in AAWindow:   
if aa in nonPolarList:   
totalNP+=1
return totalNP/10.0 #THIS SHOULD DEVIDE BY len(AAWindow) so it works for sequences less than 10 length like 'MP'

3. The last function,tmSCANNER should call the get protein region and test for TM and Ultimately, as a result the code should be used to scan each protein sequence in the list as input generating list of numbers of non polar for each protein sequence which measures the fraction of nonpolar residues in each 10bp window(it slides 10 amino acids at a time until it is at the last aa window of a protein sequence with any length and give the lists for those. The code should output what is displayed below.

#Test code for TMFinder

input=> listOfProtein=['MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR', 'MARKCSVPLVMAWLTWTTSRAPLPH', 'MPWPTSITXXXXXXSWSPEWLSSGLRSILGWEQPRVSHKGHSHEWHRRP']

tmValuesList=TMFinder(listOfProtein)

print 'The list of TM values are:', tmValuesList

as a result it should print out this list:

["protein 1:'MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR'", 'TMValue:[0.7, 0.6, 0.7, 0.7, 0.6, 0.5, 0.6, 0.5, 0.5, 0.4, 0.4, 0.4, 0.4, 0.3, 0.4, 0.5, 0.4, 0.5, 0.4, 0.5, 0.6, 0.7, 0.7, 0.8, 0.8, 0.8, 0.9, 0.8, 0.9, 0.8]',"protein2:'MARKCSVPLVMAWLTWTTSRAPLPH'", 'TMValue:[0.6, 0.6, 0.6, 0.7, 0.8, 0.8, 0.9, 0.8, 0.7, 0.6, 0.5, 0.5, 0.5, 0.5, 0.5, 0.5]',"protein3:'MPWPTSITXXXXXXSWSPEWLSSGLRSILGWEQPRVSHKGHSHEWHRRP'",'TMValue:[0.5, 0.4, 0.3, 0.2, 0.1, 0.1, 0.2, 0.1, 0.2, 0.2, 0.3, 0.4, 0.4, 0.4, 0.4, 0.5, 0.4, 0.4, 0.4, 0.5, 0.4, 0.4, 0.4, 0.4, 0.5, 0.4, 0.5, 0.5, 0.4, 0.3, 0.3, 0.2, 0.2, 0.2, 0.1, 0.2, 0.1, 0.1, 0.1]']

This is time sensitive.Thank you for the help!!!

Let Vand W be vector spaces over F, and let B( V, W) be the set of all bilinear forms f: V x W ~ F. Show that B( V, W) is a subspace of the vector space of functions 31'( V x W).

Prove that the dual space B( V, W)* satisfies the definition of tensor product, with respect to the bilinear mapping b: V x W -> B( V, W)* defined by b(v, w)(f) =f(v, w), f E B(V, W), V E V, W E W.

You performed this test cross and obtained these numbers of progeny gamete as follows:

Trihybrid Tester

v+/v. b / b+. p / p+ (♀) x v / v. b / b. p / p (♂)

Progeny

V b+ p+ 580

V+ b p 592

v b p+ 45

V+ b+ p 40

v b p 89

V+ b+ p+ 94

v b+ p 3

v+ b p+ 5

Total 1448

Compute the map distances between the loci and draw a linkage map from this information

The Canmark Research Center Airport Customer Satisfaction Survey uses an online questionnaire to provide airlines and airports with customer satisfaction ratings for all aspects of the customers' flight experience. After completing a flight, customers receive an email asking them to go to the website and rate a variety of factors, including the reservation process, the check-in process, luggage policy, cleanliness of gate area, service by flight attendants, food/beverage selection, on-time arrival, and so on. A five-point scale, with Excellent (E), Very Good (V), Good (G), Fair (F), and Poor (P), is used to record the customer ratings for each survey question. Assume that passengers on a Delta Airlines flight from Myrtle Beach, South Carolina, to Atlanta, Georgia, provided the following ratings for the question, "Please rate the airline based on your overall experience with this flight." The sample ratings are shown below.

E E G V V E V V V E
E G V E E V E E E V
V V V F V E V E G E
G E V E V E V V V V
E E V V E P E V P V

(a) Name the elements in this study

(b) Name the sample in this study

(c) Name the population of interest so that selection bias doesn't exist

(d) Name the variable in this study

(e) Based on the result, make an inference about "E"

C-Language

Modify the existing vector's contents, by erasing 200, then inserting 100 and 102 in the shown locations. Use Vector ADT's erase() and insert() only. Sample output of below program:

100 101 102 103 

----------------------------------------------------------------------------------

#include <stdio.h>
#include <stdlib.h>

// struct and typedef declaration for Vector ADT
typedef struct vector_struct {
   int* elements;
   unsigned int size;
} vector;

// Initialize vector with specified size
void vector_create(vector* v, unsigned int vectorSize) {
   int i;

   if (v == NULL) return;

   v->elements = (int*)malloc(vectorSize * sizeof(int));
   v->size = vectorSize;
   for (i = 0; i < v->size; ++i) {
      v->elements[i] = 0;
   }
}

// Resize the size of the vector
void vector_resize(vector* v, unsigned int vectorSize) {
   int oldSize;
   int i;
   if (v == NULL) return;

   oldSize = v->size;
   v->elements = (int*)realloc(v->elements, vectorSize * sizeof(int));
   v->size = vectorSize;
   for (i = oldSize; i < v->size; ++i) {
      v->elements[i] = 0;
   }
}

// Return pointer to element at specified index
int* vector_at(vector* v, unsigned int index) {
   if (v == NULL || index >= v->size) return NULL;

   return &(v->elements[index]);
}

// Insert new value at specified index
void vector_insert(vector* v, unsigned int index, int value) {
   int i;

   if (v == NULL || index > v->size) return;

   vector_resize(v, v->size + 1);
   for (i = v->size - 1; i > index; --i) {
      v->elements[i] = v->elements[i-1];
   }
   v->elements[index] = value;
}

// Insert new value at end of vector
void vector_push_back(vector* v, int value) {
   vector_insert(v, v->size, value);
}

// Erase (remove) value at specified index
void vector_erase(vector* v, unsigned int index) {
   int i;

   if (v == NULL || index >= v->size) return;

   for (i = index; i < v->size - 1; ++i) {
      v->elements[i] = v->elements[i+1];
   }
   vector_resize(v, v->size - 1);
}

// Return number of elements within vector
int vector_size(vector* v) {
   if (v == NULL) return -1;

   return v->size;
}

void PrintVectors(vector* numberList) {
   int i;

   for (i = 0; i < vector_size(numberList); ++i) {
      printf("%d ", *vector_at(numberList, i));
   }
   printf("\n");
}

int main(void) {
   vector numberList;
   vector_create(&numberList, 0);

   // Populate vector with 101 200 103
   vector_push_back(&numberList, 101);
   vector_push_back(&numberList, 200);
   vector_push_back(&numberList, 103);

   // Erase 200 then insert 100 and 102

   /* Your solution goes here */

   PrintVectors(&numberList);

   return 0;
}

If V is a linear space and S is a proper subset of V, and we define a relation on V via v1 ~ v2 iff v1 - v2 are in S, a subspace of V. We are given ~ is an equivalence relation, show that the set of equivalence classes, V/S, is a vector space as well, where the typical element of V/S is v + s, where v is any element of V.

(a).    Check

<u,v> =2u1v1+3u2v2+u3v3

is inner product space or not.

If yes assume u= (8,0,-8) & v= (8,3,16)

Find

1. ||u||
2. ||v||
3. |<u, v>|²
4. Unit vector in direction of u and v
5. Distance (u, v)
6. Angle between u and v
7. Orthogonal vectors of u and v.

(b).    Show that

<u,v> =u1v1-2u2v2+u3v3

You have been asked to see D. V. in the Neurologic Clinic on referral from his internist, who thinks his patient is having symptoms of multiple sclerosis (MS). He is a 20-year old man who has experienced increasing urinary frequency and urgency over the past 2 months. Because his female partner was treated for a sexually transmitted disease, D. V. also underwent treatment, but the symptoms did not resolve. D. V. has also recently had 2 brief episodes of eye “fuzziness” and associated with diplopia and brightness. He has noticed ascending numbness and weakness of the R arm with inability to hold objects over the past few days. Now he reports rapid progression of weakness in his legs.

1. MS is an inflammatory disorder of the nervous system causing scattered, patchy demyelinization of the CNS. What does myelin do? What is demyelinization?
2. MS is characterized by remissions and exacerbations. What happens to the myelin during each of these phases?
3. Isn’t D. V. too young to get MS? What is the etiology?
4. What assessment data from the case study caused the physician to suspect a possible diagnosis of MS?

Diagnostic tests are often done to rule out other disorders with similar symptoms. A diagnosis will be made when other disorders have been ruled out, when the patient has 2 or more exacerbations, there is slow, steady progression, and/or the patient has 2 or more areas of demyelinization or plaque formation.

1. What are 4 common diagnostic tests you can begin to teach D. V. about?
2. D. V. asks you, “If this turns out to be MS, what is the treatment?”
3. As part of your teaching plan you want D. V. to be aware of situations or factors that are known to cause an exacerbation of symptoms. List four.
4. The National Multiple Sclerosis Society, 733 3^rd Ave., 6^th Floor, New York, NY 10017-3299 (1-800-344-4867) is a great resource for D. V. What are some resources available in the community that D. V. may need referrals to?

D. V. confides in you that he tried to commit suicide at the age of 14 when his parents got a divorce. He tells you that he knows his girlfriend hasn’t been faithful but he is afraid of living alone. He admits that she occasionally hits him, but he’s afraid if he tells her about his M. S. diagnosis she’ll leave him for good. You recall seeing yellowish bruises on his arms when you took his admission blood pressure.

1. What are you going to do with this information?
2. In view of his personal history and current diagnosis, what two critical psychosocial issues are you going to monitor for in his follow-up visits?

D. V. took advantage of his time with the psychiatric nurse specialist, joined a local MS support group, and told his girlfriend to move out. He later married a woman from the support group.

n 2018, the Westgate Construction Company entered into a contract to construct a road for Santa Clara County for $10,000,000. The road was completed in 2020. Information related to the contract is as follows:

Westgate recognizes revenue over time according to percentage of completion.

Required:
1. Calculate the amount of revenue and gross profit (loss) to be recognized in each of the three years.
2-a. In the journal below, complete the necessary journal entries for the year 2018 (credit "Various accounts" for construction costs incurred).
2-b. In the journal below, complete the necessary journal entries for the year 2019 (credit "Various accounts" for construction costs incurred).
2-c. In the journal below, complete the necessary journal entries for the year 2020 (credit "Various accounts" for construction costs incurred).
3. Complete the information required below to prepare a partial balance sheet for 2018 and 2019 showing any items related to the contract.
4. Calculate the amount of revenue and gross profit (loss) to be recognized in each of the three years assuming the following costs incurred and costs to complete information.

5. Calculate the amount of revenue and gross profit (loss) to be recognized in each of the three years assuming the following costs incurred and costs to complete information.

Calculate the amount of revenue and gross profit (loss) to be recognized in each of the three years. (Do not round intermediate calculations. Loss amounts should be indicated with a minus sign.)

In the journal below, complete the necessary journal entries for the year 2018 (credit "Various accounts" for construction costs incurred). (If no entry is required for a transaction/event, select "No journal entry required" in the first account field.)

1. Record construction costs. / 2. Record progress billings. / 3. Record cash collections. / 4. Record gross profit (loss)

In the journal below, complete the necessary journal entries for the year 2019 (credit "Various accounts" for construction costs incurred). (If no entry is required for a transaction/event, select "No journal entry required" in the first account field.)

2018: 1. Record construction costs.​ / 2. Record progress billings. / 3. Record cash collections. / 4. Record gross profit (loss).

In the journal below, complete the necessary journal entries for the year 2020 (credit "Various accounts" for construction costs incurred). (If no entry is required for a transaction/event, select "No journal entry required" in the first account field.)

1. Record construction costs.​ / 2. Record progress billings. / 3. Record cash collections. / 4. Record gross profit (loss).

Complete the information required below to prepare a partial balance sheet for 2018 and 2019 showing any items related to the contract. (Do not round intermediate calculations.)