Database Design

Design a database and show the relationship between each tables. I need multiple tables. *Must meet the requirements for Third Normal Form.

These are the information for employee DB.

Employee Number, First Name, Last Name, Date of birth, Address, city, state, zip, department, job title, supervisor, health insurance number, health insurance provider, dental insurance number, dental insurance provider, spouse/partner, children, children's ages.

Carry out a BLAST search against the UniProt database using the following sequence as input: MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK -- Select from the list below ALL statements that are TRUE. *

• The name of the protein is called DSUP or damage supressor.
• The protein is a highly lethal toxin factor.
• There appears to be only one known example of the protein in the database.
• The protein comes from an organism called a water bear.
• There are at least five other homologs to the protein including egg stalk protein

1. Suppose that a simple economy produced only three goods: wheat, automobiles, and chairs. The table below lists the quantity and prices for each of the goods for year 2000 and 2010. Based on table, answer the following questions

1. Calculate nominal GDP in year 2000.
2. Suppose prices doubled by 2010 but production stayed the same. Calculate the nominal value of GDP in 2010.
3. Suppose production in wheat and chairs rose by 10 percent in 2010 compared to 2000. Automobile production fell by 5 percent. If prices remain unchanged over this period, what is nominal value of GDP in 2010?

python 3.6:

You will have two functions:

Function 1: update(user_dictionary): This function will take a dictionary entry as user that has keys, ‘username’,’password’,’uid’, and ‘gid’ along with values. You will search if the username is already in your user_list that you get from your userfile.json file that you have created in your previous task.

If the username in your user_dictionary is not in the list that is in your .json file then add the user_dictionary into the existing list and update your userfile.json with the new entry.

If the username in your user_dictionary isin the list that is in your .json file then just update the fields password,uid, and gid based on the information provided.

Function 2: delete(user_name): This function will take a username and remote entry associated with the user.

Previous Task Code:

#!/usr/bin/env python3.6
import pwd
import json

#Task 1
list=pwd.getpwall()
dictionary={}
print(list)
for i in range(len(list)):
with open('list.json','a') as f:
json.dump(list[i].pw_name,f)
json.dump(list[i].pw_passwd,f)

Accounting Information systems

Lakers Athletics is an online store that sells athletic gear for LA Lakers’ fans. Lakers Athletics uses the Internet to take customers orders and deliver the goods. Lakers Athletics operates in Pomona and provides delivery to precertified customers.

Lakers Athletics uses a website to post the merchandise they offer. Customers can view the website to see the catalog of inventory items that are available. The sales process is triggered by a customer accessing Lakers Athletics’ inventory catalog and deciding what and if to order. If the customer sees an item they would like to order, they post a customer order within Lakers Athletics’ sales database.

Periodically, throughout the day, Lakers Athletics’ sales manager accesses the sales database and reviews customer initiated customer orders. The sales manager checks customer credit by reviewing the customer database. The sales manager keys in either an acceptance or denial of the customer order, entering a sales order into the sales database when approved. The customer is notified electronically through a transmission from the sales system. If the order is accepted, this transmission takes the form of an electronic sales order; if it is rejected, the transmission is simply an electronic mail message of denial.

Goods are shipped to the customer within 3 days, a printout of the authorized sales order is attached, acting as a packing slip. The shipping department keys the sales order information into the sales database to make sure the shipment is authorized. They then record the sales order as shipped in the sales database. Goods are at times not available—thus out of stock. If the warehouse crew is unable to locate the item requested by the customer, or a suitable substitute, no shipment takes place. The customer receives an email asking them if they wish to wait for the item to arrive from the supplier and be shipped to them.

At the beginning of the following day, the cash receipts officer connects to the sales database to review the shipped goods, and updates the accounts receivable balances. Per agreement with customers, all payments are due within 30 days after receipt of shipped athletic goods. Customers epay for merchandise by credit card or bank transfers. When a customer pays by credit card (or bank transfer), they email their credit card (or bank) information to Lakers Athletics on a credit card (or bank) authorization form. Lakers uses this information to request payment from the National Credit Card Bank (or customer bank). When approved, a monetary transfer is received from the National Credit Card Bank (or customer bank) to Lakers Athletics’ local bank. A confirmation number is received from the local bank, and the cash receipts officer enters the confirmation number into the sales database. This event serves to confirm completion of the payment from the customer.

Requirement: You Need to find Entities and Activities, and along with a chronological table with groups !! Thank you

in this assignment you will create and use a database to find meanings and synonyms for given phrases. To do so you will use tables of synsets -- sets of one or more synonyms (specific phrases) that share the same meaning.

Your program should:

1. Display a message stating its goal
2. Create a database file using SQLite using your name (i.e. use your name as a file name - for example, my database will be named "nimdvir")
3. In your database, create a table named "synsets" with the columns "SynsetID" and "Definition", and populate it with values from the attached text file "Synsets" (also available to download here - https://drive.google.com/file/d/1qmj518lIjTFn6xifnd_PCl6AadY_JeG8/view?usp=sharing)
4. In your database, create a table named "phrases" with the columns "SynsetID" and "phrase", and populate it with values from the attached text file "Phrases" (also available to download here - https://drive.google.com/file/d/1r-JZrF_Ei7a2_FPhXJqo9b-i8nvpqMbc/view?usp=sharing)
5. Hint 1: make sure the encoding is correct (see previous readings)
6. Hint 2: make sure you parse the text files correctly
7. Hint 3: it is recommended not to import all the data while you are still working on the program. Use just a few values to make sure your program runs correctly, and them change it to import all the values from the files.
8. Ask the user to enter a phrase and check if it's in the database (not case sensitive)
9. If it's not in the database display a message and prompt the user to try again
10. If it is in the database, return as output:
11. How many meanings the phrase has? (in how many synsets it appear)
12. How many unique synonyms the phrase has? (how many other phrases share the same synsets? Make sure to not count the phrase itself or the same phrase twice)
13. Display all the meanings (definitions) the phrase has, including their corresponding Synset ID
14. Below each definition out the correlating synonyms

For example, for the phrase "jail"

there are 2 meanings and 11 unique synonyms

Meaning 1:

lock up or confine, in or as in a jail

Synset ID:

2494356

Synonyms:

gaol

• immure
• jailed
• jug
• lag
• laggin
• remand

Meaning 2:

A correctional institution used to detain persons who are in the lawful custody of the government (either accused persons awaiting trial or convicted persons serving a sentence)

Synset ID:

3592245

Synonyms:

clink

• gaol
• pokey
• poky
• slammer
• Remember:

Only use the material covered in this module -- do not use more advanced functions not covered yet in the course

• Make sure to include comments that explain all your steps (starts with #). Also use a comment to sign your name at the beginning of the program!
• Work individually and only submit original work

Submit a .py file!

Using two peer-reviewed articles, give a short summary of the current best practices in the traditional environment, that is identified in the nursing research literature.

what are the similarities and differences between traditional and online teaching practices.

-citations needed

Discuss current changes to the criteria previously used to diagnose and treat autism. How was autism diagnosed and treated previously? How will it be diagnosed and treated now? What factors influence ASD? Explain.

note citations and refrences please

Discuss current changes to the criteria previously used to diagnose and treat autism. How was autism diagnosed and treated previously? How will it be diagnosed and treated now? What factors influence ASD? Explain.

note citations and refrences please