Questions
USE Python 2.7(screen shot program with output) the task is: takes in a list of protein...

USE Python 2.7(screen shot program with output)

the task is: takes in a list of protein sequences as input and finds all the transmembrane domains and returns them in a list for each sequence in the list with given nonpolar regions and returns the lists for those.

1. This code should call two other functions that you write: regionProteinFind takes in a protein sequence and should return a list of 10 amino acid windows, if the sequence is less than 10 amino acids, it should just return that sequence. (initially it should grab amino acids 1-10…the next time it is called it should grab amino acids 2-11…) for each sequence in the list.

testcode:

"protein='MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR''

the regionProteinFind returns:['MKLVVRPWAG','KLVVRPWAGC','LVVRPWAGCW','VVRPWAGCWW','VRPWAGCWWS','RPWAGCWWST','PWAGCWWSTL','WAGCWWSTLG','AGCWWSTLGP','GCWWSTLGPR',
'CWWSTLGPRG','WWSTLGPRGS','WSTLGPRGSL','STLGPRGSLS','TLGPRGSLSP','LGPRGSLSPL','GPRGSLSPLG','PRGSLSPLGI','RGSLSPLGIC','GSLSPLGICP','SLSPLGICPL','LSPLGICPLL','SPLGICPLLM','PLGICPLLML','LGICPLLMLL','GICPLLMLLW','ICPLLMLLWA','CPLLMLLWAT','PLLMLLWATL','LLMLLWATLR']

2nd testcode;

protein=MP

region protein sequence should return: ['ME']

2. A second function called testForTM , which should calculate and return the decimal fraction of ten amino acid window which are nonpolar for each sequence in the list. the nonpolar regions are (A,V,L,I,P,M,F,W). my code for this is:

def testForTM(AAWindow):
totalNP= 0
nonPolarList=['A', 'V', 'L', 'I', 'P', 'M', 'F', 'W']
for aa in AAWindow:   
if aa in nonPolarList:   
totalNP+=1
return totalNP/10.0 #THIS SHOULD DEVIDE BY len(AAWindow) so it works for sequences less than 10 length like 'MP'

3. The last function,tmSCANNER should call the get protein region and test for TM and Ultimately, as a result the code should be used to scan each protein sequence in the list as input generating list of numbers of non polar for each protein sequence which measures the fraction of nonpolar residues in each 10bp window(it slides 10 amino acids at a time until it is at the last aa window of a protein sequence with any length and give the lists for those. The code should output what is displayed below.

#Test code for TMFinder

input=> listOfProtein=['MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR', 'MARKCSVPLVMAWLTWTTSRAPLPH', 'MPWPTSITXXXXXXSWSPEWLSSGLRSILGWEQPRVSHKGHSHEWHRRP']

tmValuesList=TMFinder(listOfProtein)

print 'The list of TM values are:', tmValuesList

as a result it should print out this list:

["protein 1:'MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR'", 'TMValue:[0.7, 0.6, 0.7, 0.7, 0.6, 0.5, 0.6, 0.5, 0.5, 0.4, 0.4, 0.4, 0.4, 0.3, 0.4, 0.5, 0.4, 0.5, 0.4, 0.5, 0.6, 0.7, 0.7, 0.8, 0.8, 0.8, 0.9, 0.8, 0.9, 0.8]',"protein2:'MARKCSVPLVMAWLTWTTSRAPLPH'", 'TMValue:[0.6, 0.6, 0.6, 0.7, 0.8, 0.8, 0.9, 0.8, 0.7, 0.6, 0.5, 0.5, 0.5, 0.5, 0.5, 0.5]',"protein3:'MPWPTSITXXXXXXSWSPEWLSSGLRSILGWEQPRVSHKGHSHEWHRRP'",'TMValue:[0.5, 0.4, 0.3, 0.2, 0.1, 0.1, 0.2, 0.1, 0.2, 0.2, 0.3, 0.4, 0.4, 0.4, 0.4, 0.5, 0.4, 0.4, 0.4, 0.5, 0.4, 0.4, 0.4, 0.4, 0.5, 0.4, 0.5, 0.5, 0.4, 0.3, 0.3, 0.2, 0.2, 0.2, 0.1, 0.2, 0.1, 0.1, 0.1]']

This is time sensitive.Thank you for the help!!!

In: Computer Science

Keller Cosmetics maintains a profit margin of 5 percent and asset turnover ratio of 3 What...

Keller Cosmetics maintains a profit margin of 5 percent and asset turnover ratio of 3

What is its ROA?

If its debt-equity ratio is 1.0, its interest payments and taxes are each $8,000, and EBIT is $20,000, what is its ROE?

In: Finance

How do you calculate the Theoretical standards of the cell potentials for all 6 (1.0 M)...

How do you calculate the Theoretical standards of the cell potentials for all 6 (1.0 M) cells listed below?

Cu+2 and Zn
Cu+2 and Pb
Cu+2 and Ni

Zn and Pb
Zn and Ni
Pb and Ni

In: Chemistry

A lipophilic drug with a pK = 6.0 is taken orally and dissolves in the gastric...

A lipophilic drug with a pK = 6.0 is taken orally and dissolves in the gastric environment of the stomach (pH = 1.0).

What is the degree of ionization of the drug in the stomach and the blood plasma (pH = 7.4)?

In what diretion will this drug tend to passively diffuse between the two compartments?

In: Chemistry

If you mix three Dixie cups continents together containing .05 L of 1.0 M lemonade, .05...

If you mix three Dixie cups continents together containing .05 L of 1.0 M lemonade, .05 L of 2.5 M lemonade, and .05 L of .5M lemonade, what would be the molarity of the resulting solution?
Show work please

In: Chemistry

How much energy (J) is contained in 2.0 kg of water if its natural deuterium is...

How much energy (J) is contained in 2.0 kg of water if its natural deuterium is used in the fusion reaction of 21H+21H?31H+ 11H?

Compare to the energy obtained from the burning of 2.0 kg of gasoline, about 1.0×108 J .

In: Physics

Find the equilibrium concentration of the Mn(C2O4)2− ion(in M) when 0.50 L of 0.030 M Mn(NO3)2...

Find the equilibrium concentration of the Mn(C2O4)2− ion(in M) when 0.50 L of 0.030 M Mn(NO3)2 are mixed with 1.0 L of 1.2M Na2C2O4. Kf of Mn(C2O4)2 2- is 6.3 x 10 5.

In: Chemistry

Water flows through a circular pipe with a constant radius of 5.0 cm. The speed and...

Water flows through a circular pipe with a constant radius of 5.0 cm. The speed and pressure at point A is 2.0 m/s and 2.0 x10^5 Pa respectively. What is the pressure at point B, which is 1.0 m higher than at point A.

In: Physics

1. Discuss the evoultion of Malaysia tax from Sales and service tax (SST) 1.0 to GST...

1. Discuss the evoultion of Malaysia tax from Sales and service tax (SST) 1.0 to GST to SST 2.0.

2. Discuss the issues and challenges of shifting from GST to SST from the perspective of Ministry of Domestic Trade and Consumer Affairs in Malaysia.

In: Accounting

At –80°C, K for the reaction N2O4(g) 2NO2(g) is 4.66 × 10–8. We introduce 0.049 mole...

At –80°C, K for the reaction N2O4(g) 2NO2(g) is 4.66 × 10–8. We introduce 0.049 mole of N2O4 into a 1.0-L vessel at –80°C and let equilibrium be established. The total pressure in the system at equilibrium will be: (0.78 atm)

In: Chemistry